This work is licensed under a Creative Commons Attribution 4.0 International License.
CRAMP
General Information
DCTPep ID DCTPep00012
Peptide Name CRAMP
Sequence ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Sequence Length 38
UniProt ID Not available
PubChem CID Not available
Origin Mus musculus
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| Jurkat E6.1 | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | IC50=16 µM | MTT assay | 3 days | 1 |
| A549 | Lung adenocarcinoma | IC50=22 µM | MTT assay | 3 days | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL14 positive; Chronic myeloid leukemia | IC50=28 µM | MTT assay | 3 days | 1 |
Hemolytic Activity Human erythrocytes: 2% Hemolysis=100 µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00012
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C197H338N56O50
Absent amino acids CDHMTWY
Theoretical pI 10.46
Acidic residues 3
Basic residues 10
Polar residues 7
Molecular weight (Average) 4291.2
Molecular weight (Monoisotopic) 4288.56
Common amino acids K
Net charge 7
Instability index (II) 17.1
Aliphatic index 102.63
Grand average of hydropathicity (GRAVY) -0.582
Half Life
20 hours (mammalian reticulocytes, in vitro).
30 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 10973820
Title CRAMP analogues having potent antibiotic activity against bacterial, fungal, and tumor cells without hemolytic activity
Year 2000
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.