This work is licensed under a Creative Commons Attribution 4.0 International License.
HNP-1
General Information
DCTPep ID DCTPep00022
Peptide Name HNP-1
Sequence ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Sequence Length 30
PubChem CID 16130476
Origin Human alpha-defensins
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| RCCs (A-498, Caki-2, 786-0, 769-P, ACHN, LE 9211-RCC, TW33, N43) | Renal Cell Carcinoma | At higher concentrations than 25 μg/ml, HNPs-1, -2, and -3 exerted cytotoxic effects on all tested RCC lines in an in vitro serum-free culture system (at lower concentrations they stimulated cell grow | WST-1 assay | 40 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID 2KHT 3HJ2 3LVX 4LBB 3HJD
Predicted Structure DCTPep00022
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys2<--->Cys30; Cys4<--->Cys19; Cys9<--->Cys29
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C150H228N44O38S6
Absent amino acids DHKMNSV
Theoretical pI 8.68
Acidic residues 1
Basic residues 4
Polar residues 13
Molecular weight (Average) 3448.09
Molecular weight (Monoisotopic) 3445.56
Common amino acids C
Net charge 3
Instability index (II) 55.71
Aliphatic index 65.33
Grand average of hydropathicity (GRAVY) 0.300
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 10345
Abs 0.1% (=1 g/l) 3.000, assuming all pairs of Cys residues form cystines
Ext. coefficient 9970
Abs 0.1% (=1 g/l) 2.891, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 11943716
Title Human alpha-defensins HNPs-1, -2, and -3 in renal cell carcinoma: influences on tumor cell proliferation
Doi 10.1016/s0002-9440(10)62558-8
Year 2002
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
CancerPPD ID 4430
This work is licensed under a Creative Commons Attribution 4.0 International License.