HNP-3

General Information


DCTPep ID  DCTPep00024

Peptide Name   HNP-3

Sequence  DCYCRIPACIAGERRYGTCIYQGRLWAFCC

Sequence Length  30

UniProt ID  P59665  Q6EZE9 

PubChem CID  16130868 

Origin  Human alpha-defensins

Type  Native peptide

Classification

  

ACP Tumor active peptide Membrane-targeted



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
RCCs (A-498, Caki-2, 786-0, 769-P, ACHN, LE 9211-RCC, TW33, N43) Renal Cell Carcinoma At higher concentrations than 25 μg/ml, HNPs-1, -2, and -3 exerted cytotoxic effects on all tested RCC lines in an in vitro serum-free culture system (at lower concentrations they stimulated cell grow WST-1 assay  40 h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00024

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys2<--->Cys30; Cys4<--->Cys19; Cys9<--->Cys29

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C151H228N44O40S6

Absent amino acids  HKMNSV

Theoretical pI  8.33

Acidic residues  2

Basic residues  4

Polar residues  13

Molecular weight (Average)  3492.1

Molecular weight (Monoisotopic)  3489.55

Common amino acids  C

Net charge  2

Instability index (II)  41.06

Aliphatic index  62.00

Grand average of hydropathicity (GRAVY)  0.123

Half Life 
  1.1 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 10345
  Abs 0.1% (=1 g/l) 2.962, assuming all pairs of Cys residues form cystines
  Ext. coefficient 9970
  Abs 0.1% (=1 g/l) 2.855, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 11943716

Title  Human alpha-defensins HNPs-1, -2, and -3 in renal cell carcinoma: influences on tumor cell proliferation

Doi 10.1016/s0002-9440(10)62558-8

Year  2002

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




CancerPPD ID  4432

DCTPep is developed by Dr.Zheng's team.