This work is licensed under a Creative Commons Attribution 4.0 International License.
Ligatoxin-B
General Information
DCTPep ID DCTPep00047
Peptide Name Ligatoxin-B
Sequence KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH
Sequence Length 46
UniProt ID Not available
PubChem CID Not available
Origin Phoradendron liga
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| U-937/GTB | Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=1.8 µM | FMCA assay | 72h | 1 |
| ACHN | Papillary renal cell carcinoma | IC50=3.2 µM | FMCA assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00047
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys3<--->Cys40; Cys4<--->Cys32; Cys16<---Cys26
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C194H319N63O67S6
Absent amino acids EFMQ
Theoretical pI 8.94
Acidic residues 1
Basic residues 6
Polar residues 28
Molecular weight (Average) 4798.41
Molecular weight (Monoisotopic) 4795.18
Common amino acids S
Net charge 5
Instability index (II) 57.57
Aliphatic index 55.22
Grand average of hydropathicity (GRAVY) -0.193
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 1.535, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.457, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 12049612
Title Ligatoxin B, a new cytotoxic protein with a novel helix-turn-helix DNA-binding domain from the mistletoe Phoradendron liga
Year 2002
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.