Peptide Libraray

FIV-NCSU1 HR2 T1971 (733-767)

General Information

DCTPep ID DCTPep00050

Peptide Name FIV-NCSU1 HR2 T1971 (733-767)

Sequence GEWYNQTKDLQQKFYEIIMDIEQNNVQGKKGIQQL

Sequence Length 35

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Membrane-targeted

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HeLa	Human papillomavirus-related endocervical adenocarcinoma	no cytotoxic effects up to 23 μM	XTT assay	24h	1

Hemolytic Activity Human erythrocytes: Not active up to 1024 µg/ml

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00050

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Acetylation

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C188H292N50O59S1

Absent amino acids ACHPRS

Theoretical pI 4.94

Acidic residues 5

Basic residues 4

Polar residues 9

Molecular weight (Average) 4228.75

Molecular weight (Monoisotopic) 4226.11

Common amino acids Q

Net charge -1

Instability index (II) 44.87

Aliphatic index 75.14

Grand average of hydropathicity (GRAVY) -1.114

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 2.005

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 12186891

Title C-Terminal gp40 peptide analogs inhibit feline immunodeficiency virus: cell fusion and virus spread

Doi 10.1128/jvi.76.18.9079-9086.2002

Year 2002

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available