This work is licensed under a Creative Commons Attribution 4.0 International License.
Cycloviolacin O2
General Information
DCTPep ID DCTPep00073
Peptide Name Cycloviolacin O2
Sequence GIPCGESCVWIPCISSAIGCSCKSKVCYRN
Sequence Length 30
UniProt ID C0HLP8
PubChem CID Not available
Origin Viola odorata
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | CC50=0.64±0.02 µM | Resazurin assay | 24h | 4 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | CC50=0.82±0.20 µM | Resazurin assay | 24h | 4 |
| MCF-7 | Invasive breast carcinoma of no special type | CC50=1.77±0.10 µM | Resazurin assay | 24h | 4 |
| CLL (Primary Human Cells) | Chronic lymphocytic leukemia | IC50=0.1 µM | FMCA assay | 72h | 1 |
| CCRF-CEM | Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia | IC50=0.11 µM | FMCA assay | 72h | 1 |
| NCI-H69 | Lung small cell carcinoma; Small cell lung cancer | IC50=0.12 µM | FMCA assay | 72h | 1 |
| RPMI-8226/Dox40 | Plasma cell myeloma; Multiple myeloma | IC50=0.12 µM | FMCA assay | 72h | 1 |
| RPMI-8226/LR-5 | Plasma cell myeloma; Multiple myeloma | IC50=0.12 µM | FMCA assay | 72h | 1 |
| RPMI-8226/s | Plasma cell myeloma; Multiple myeloma | IC50=0.12 µM | FMCA assay | 72h | 1 |
| CCRF-CEM/VM-1 | Not available | IC50=0.14 µM | FMCA assay | 72h | 1 |
| U-937/Vcr | Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=0.20 µM | FMCA assay | 72h | 1 |
| ACHN | Papillary renal cell carcinoma; Papillary renal cell carcinoma | IC50=0.22 µM | FMCA assay | 72h | 1 |
| NCI-H69AR | Lung small cell carcinoma; Small cell lung cancer | IC50=0.26 µM | FMCA assay | 72h | 1 |
| U-937/GTB | Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=0.26 µM | FMCA assay | 72h | 1 |
| OVCA (Primary Human Cells) | Ovarian carcinoma | IC50=1.32 µM | FMCA assay | 72h | 1 |
| U251 | Astrocytoma | IC50=17.05 µg/ml | SRB assay | 48h | 2 |
| MDA-MB-231 | Breast adenocarcinoma | IC50=4.81 µg/ml | SRB assay | 48h | 2 |
| DU145 | Prostate carcinoma | IC50=5.08 µg/ml | SRB assay | 48h | 2 |
| A549 | Lung adenocarcinoma | IC50=5.99 µg/ml | SRB assay | 48h | 2 |
| BEL-7402 | Human papillomavirus-related endocervical adenocarcinoma | IC50=6.07 µg/ml | SRB assay | 48h | 2 |
Hemolytic Activity HRBCs: HC50=25.60 ± 1.93 µM
Normal (non-cancerous) Cytotoxicity PBMC: IC50=0.87 µM; HUVEC: CC50=0.80 ± 0.03 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
Predicted Structure DCTPep00073
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C133H215N37O40S6
Absent amino acids DFHLMQT
Theoretical pI 8.33
Acidic residues 1
Basic residues 3
Polar residues 16
Molecular weight (Average) 3164.75
Molecular weight (Monoisotopic) 3162.43
Common amino acids C
Net charge 2
Instability index (II) 25.08
Aliphatic index 74.67
Grand average of hydropathicity (GRAVY) 0.443
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.327, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.209, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 12477048
Title Cyclotides: a novel type of cytotoxic agents
Doi 10.1097/00008390-200204000-00013
Year 2002
Literature 2
Pubmed ID 20580652
Title Isolation and characterization of cytotoxic cyclotides from Viola tricolor
Doi 10.1016/j.peptides.2010.05.004
Year 2010
Literature 3
Pubmed ID 10600388
Title Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif
Year 1999
Literature 4
Pubmed ID 32414842
Title Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.