Cycloviolacin O2

General Information


DCTPep ID  DCTPep00073

Peptide Name   Cycloviolacin O2

Sequence  GIPCGESCVWIPCISSAIGCSCKSKVCYRN

Sequence Length  30

UniProt ID  C0HLP8 

PubChem CID  Not available

Origin  Viola odorata

Type  Native peptide

Classification

  

ACP Tumor active peptide Membrane-targeted



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
K562 Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia CC50=0.64±0.02 µM Resazurin assay 24h 4
HeLa Human papillomavirus-related endocervical adenocarcinoma CC50=0.82±0.20 µM Resazurin assay 24h 4
MCF-7 Invasive breast carcinoma of no special type CC50=1.77±0.10 µM Resazurin assay 24h 4
CLL (Primary Human Cells) Chronic lymphocytic leukemia IC50=0.1 µM FMCA assay 72h 1
CCRF-CEM Childhood T acute lymphoblastic leukemia; Precursor T-cell acute lymphoblastic leukemia IC50=0.11 µM FMCA assay 72h 1
NCI-H69 Lung small cell carcinoma; Small cell lung cancer IC50=0.12 µM FMCA assay 72h 1
RPMI-8226/Dox40 Plasma cell myeloma; Multiple myeloma IC50=0.12 µM FMCA assay 72h 1
RPMI-8226/LR-5 Plasma cell myeloma; Multiple myeloma IC50=0.12 µM FMCA assay 72h 1
RPMI-8226/s Plasma cell myeloma; Multiple myeloma IC50=0.12 µM FMCA assay 72h 1
CCRF-CEM/VM-1 Not available IC50=0.14 µM FMCA assay 72h 1
U-937/Vcr Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia IC50=0.20 µM FMCA assay 72h 1
ACHN Papillary renal cell carcinoma; Papillary renal cell carcinoma IC50=0.22 µM FMCA assay 72h 1
NCI-H69AR Lung small cell carcinoma; Small cell lung cancer IC50=0.26 µM FMCA assay 72h 1
U-937/GTB Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia IC50=0.26 µM FMCA assay 72h 1
OVCA (Primary Human Cells) Ovarian carcinoma IC50=1.32 µM FMCA assay 72h 1
U251 Astrocytoma IC50=17.05 µg/ml SRB assay 48h 2
MDA-MB-231 Breast adenocarcinoma IC50=4.81 µg/ml SRB assay 48h 2
DU145 Prostate carcinoma IC50=5.08 µg/ml SRB assay 48h 2
A549 Lung adenocarcinoma IC50=5.99 µg/ml SRB assay 48h 2
BEL-7402 Human papillomavirus-related endocervical adenocarcinoma IC50=6.07 µg/ml SRB assay 48h 2

Hemolytic Activity  HRBCs: HC50=25.60 ± 1.93 µM

Normal (non-cancerous) Cytotoxicity  PBMC: IC50=0.87 µM; HUVEC: CC50=0.80 ± 0.03 µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  2KCG  7RMQ 

Predicted Structure  DCTPep00073

(Please note that there is the predicted structure, predicted by AlphaFold)

SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C133H215N37O40S6

Absent amino acids  DFHLMQT

Theoretical pI  8.33

Acidic residues  1

Basic residues  3

Polar residues  16

Molecular weight (Average)  3164.75

Molecular weight (Monoisotopic)  3162.43

Common amino acids  C

Net charge  2

Instability index (II)  25.08

Aliphatic index  74.67

Grand average of hydropathicity (GRAVY)  0.443

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7365
  Abs 0.1% (=1 g/l) 2.327, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 2.209, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 12477048

Title  Cyclotides: a novel type of cytotoxic agents

Doi 10.1097/00008390-200204000-00013

Year  2002

Literature 2

Pubmed ID 20580652

Title  Isolation and characterization of cytotoxic cyclotides from Viola tricolor

Doi 10.1016/j.peptides.2010.05.004

Year  2010

Literature 3

Pubmed ID 10600388

Title  Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif

Doi 10.1006/jmbi.1999.3383

Year  1999

Literature 4

Pubmed ID 32414842

Title  Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus

Doi 10.1074/jbc.RA120.012627

Year  2020

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.