Peptide Libraray

vibi G

General Information

DCTPep ID DCTPep00188

Peptide Name vibi G

Sequence GTFPCGESCVFIPCLTSAIGCSCKSKVCYKN

Sequence Length 31

UniProt ID P85245

PubChem CID Not available

Origin V. biflora

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
U-937	Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia	IC50=0.96 μM	Fluorometric microculture cytotoxicity assay	72 h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00188

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C139H221N35O42S6

Absent amino acids DHMQRW

Theoretical pI 8.33

Acidic residues 1

Basic residues 3

Polar residues 17

Molecular weight (Average) 3246.85

Molecular weight (Monoisotopic) 3244.46

Common amino acids C

Net charge 2

Instability index (II) 37.19

Aliphatic index 59.68

Grand average of hydropathicity (GRAVY) 0.471

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.574, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.459, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 18191970

Title The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity

Doi 10.1016/j.phytochem.2007.10.023

Year 2008

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available