vibi E
General Information
DCTPep ID DCTPep00190
Peptide Name vibi E
Sequence GIPCAESCVWIPCTVTALIGCGCSNKVCYN
Sequence Length 30
UniProt ID B1NRQ8
PubChem CID Not available
Origin V. biflora
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
Cell Line | Disease | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|
U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | IC50=3.2 μM | Fluorometric microculture cytotoxicity assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00190
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C132H210N34O40S6
Absent amino acids DFHMQR
Theoretical pI 5.96
Acidic residues 1
Basic residues 1
Polar residues 16
Molecular weight (Average) 3105.68
Molecular weight (Monoisotopic) 3103.38
Common amino acids C
Net charge 0
Instability index (II) 27.76
Aliphatic index 87.67
Grand average of hydropathicity (GRAVY) 0.817
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.371, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.251, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18191970
Title The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity
Doi 10.1016/j.phytochem.2007.10.023
Year 2008
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available