Cecropin A
General Information
DCTPep ID DCTPep00192
Peptide Name Cecropin A
Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Sequence Length 37
UniProt ID P01507
PubChem CID 16132345
Origin Hyalophora Cecropia(silkmoth)
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| 647V | Bladder carcinoma | IC50=185.39 µg/ml | WST-1 assay | 48 h | 1 |
| 647V | Bladder carcinoma | IC50=200.7 µg/ml | LDH leakage assay | 48 h | 1 |
| J82 | Bladder carcinoma | IC50=212.07 µg/ml | WST-1 assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | IC50=231.26 µg/ml | WST-1 assay | 48 h | 1 |
| 486P | Bladder carcinoma | IC50=251.47 µg/ml | WST-1 assay | 48 h | 1 |
| 647V | Bladder carcinoma | IC50=28.74 µg/ml | BrdU assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | IC50=289.3 µg/ml | LDH leakage assay | 48 h | 1 |
| J82 | Bladder carcinoma | IC50=319.2 µg/ml | LDH leakage assay | 48 h | 1 |
| 486P | Bladder carcinoma | IC50=373.3/ µg/ml | LDH leakage assay | 48 h | 1 |
| 486P | Bladder carcinoma | IC50=69.2 µg/ml | BrdU assay | 48 h | 1 |
| RT-4 | Bladder carcinoma | IC50=96.22 µg/ml | BrdU assay | 48 h | 1 |
| J82 | Bladder carcinoma | IC50=99.01 µg/ml | BrdU assay | 48 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Normal murine or human fibroblasts: low cytotoxic
Target Not available
Affinity Not available
Mechanism Cecropin A and B inhibit bladder cancer cell proliferation and viability in a dose-dependent fashion
Structure Information
PDB ID Not available
Predicted Structure DCTPep00192
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C184H312N52O47
Absent amino acids CHMSY
Theoretical pI 10.39
Acidic residues 2
Basic residues 8
Polar residues 6
Molecular weight (Average) 4004.82
Molecular weight (Monoisotopic) 4002.36
Common amino acids K
Net charge 6
Instability index (II) 16.52
Aliphatic index 108.11
Grand average of hydropathicity (GRAVY) -0.073
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.373
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 18315881
Title Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells
Year 2008
Literature 2
Pubmed ID 6579533
Title Solid-phase synthesis of cecropin A and related peptides
Year 1983
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_571 DBAASPR_571