Peptide Libraray

Ceropin

General Information

DCTPep ID DCTPep00232

Peptide Name Ceropin

Sequence MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG

Sequence Length 63

UniProt ID Not available

PubChem CID Not available

Origin Musca domestica

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	35.2 % Cell viability at 100 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	41.1 % Cell viability at 75 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	48.6 % Cell viability at 100 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	49.7 % Cell viability at 50 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	54.2 % Cell viability at 100 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	54.3 % Cell viability at 100 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	62.8 % Cell viability at 75 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	63.3 % Cell viability at 25 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	71.5 % Cell viability at 75 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	72.1 % Cell viability at 12.5 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	75.6 % Cell viability at 50 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	76.3% Cell viability at 50 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	84.1% Cell viability at 25 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	87.3 % Cell viability at 25 µM	Trypan blue assay	48 h	1
BEL-7402	Human papillomavirus-related endocervical adenocarcinoma	91.8% Cell viability at 12.5 µM	Trypan blue assay	48 h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism cecropin can induce apoptosis of the human hepatoma BEL-7402 cells, which might be associated with up-regulation of Fas, Fas-L, caspase-8, and caspase-3

Structure Information

PDB ID Not available

Predicted Structure DCTPep00232

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C304H502N86O83S2

Absent amino acids PY

Theoretical pI 10.02

Acidic residues 3

Basic residues 9

Polar residues 15

Molecular weight (Average) 6753.98

Molecular weight (Monoisotopic) 6749.71

Common amino acids A

Net charge 6

Instability index (II) 23.22

Aliphatic index 108.41

Grand average of hydropathicity (GRAVY) 0.300

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 0.814, assuming all pairs of Cys residues form cystines
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 0.814, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 20383464

Title Apoptosis-inducing activity of the antimicrobial peptide cecropin of Musca domestica in human hepatocellular carcinoma cell line BEL-7402 and the possible mechanism

Doi 10.1093/abbs/gmq021

Year 2010

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available