Psyle E
General Information
DCTPep ID DCTPep00237
Peptide Name Psyle E
Sequence GVIPCGESCVFIPCISSVLGCSCKNKVCYRD
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Micronesian Plant Psychotria leptothyrsa
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| U-937 | Adult acute monocytic leukemi; Acute monoblastic/monocytic leukemia | IC50=0.76 μM | Nonclonogenic fluorometric microculture cytotoxicity assay | 72 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00237
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C139H227N37O42S6
Absent amino acids AHMQTW
Theoretical pI 7.77
Acidic residues 2
Basic residues 3
Polar residues 15
Molecular weight (Average) 3280.91
Molecular weight (Monoisotopic) 3278.51
Common amino acids C
Net charge 1
Instability index (II) 30.99
Aliphatic index 87.74
Grand average of hydropathicity (GRAVY) 0.652
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.568, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.454, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 20575512
Title Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa
Year 2010
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available