This work is licensed under a Creative Commons Attribution 4.0 International License.
Cliotides T2, CT2
General Information
DCTPep ID DCTPep00284
Peptide Name Cliotides T2, CT2
Sequence GEFLKCGESCVQGECYTPGCSCDWPICKKN
Sequence Length 30
UniProt ID G1CWH1
PubChem CID Not available
Origin Clitoria ternatea
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | IC50=7.59 µM | MTT assay | 72 h | 2 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | IC50=8.0 μM | MTT assay | 72 h | 1 |
Hemolytic Activity Human red blood cells: HD50=8.0 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00284
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys6<--->Cys20; Cys10<--->Cys22; Cys15<--->Cys27; NCB: Gly1<--->Asn30
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C138H210N36O45S6
Absent amino acids AHMR
Theoretical pI 4.87
Acidic residues 4
Basic residues 3
Polar residues 15
Molecular weight (Average) 3285.76
Molecular weight (Monoisotopic) 3283.36
Common amino acids C
Net charge -1
Instability index (II) 43.17
Aliphatic index 35.67
Grand average of hydropathicity (GRAVY) -0.390
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.241, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.127, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21596752
Title Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family
Year 2011
Literature 2
Pubmed ID 23419988
Title Chemosensitizing activities of cyclotides from Clitoria ternatea in paclitaxel-resistant lung cancer cells
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4275
This work is licensed under a Creative Commons Attribution 4.0 International License.