Cliotides T4, CT4

General Information


DCTPep ID  DCTPep00285

Peptide Name   Cliotides T4, CT4

Sequence  GIPCGESCVFIPCITAAIGCSCKSKVCYRN

Sequence Length  30

UniProt ID  G1CWH3  P86902 

PubChem CID  Not available

Origin  Clitoria ternatea

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
A549 Lung adenocarcinoma IC50=0.21 µM MTT assay 72 h 2
HeLa Human papillomavirus-related endocervical adenocarcinoma IC50=0.6 μM MTT assay 72 h 1

Hemolytic Activity  Human red blood cells: HD50=0.6 μM

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00285

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C132H216N36O39S6

Absent amino acids  DHLMQW

Theoretical pI  8.33

Acidic residues  1

Basic residues  3

Polar residues  15

Molecular weight (Average)  3123.74

Molecular weight (Monoisotopic)  3121.43

Common amino acids  C

Net charge  2

Instability index (II)  18.66

Aliphatic index  78.00

Grand average of hydropathicity (GRAVY)  0.657

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1865
  Abs 0.1% (=1 g/l) 0.597, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.477, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 21596752

Title  Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family

Doi 10.1074/jbc.M111.229922

Year  2011

Literature 2

Pubmed ID 23419988

Title  Chemosensitizing activities of cyclotides from Clitoria ternatea in paclitaxel-resistant lung cancer cells

Doi 10.3892/ol.2012.1042

Year  2013

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4278

DCTPep is developed by Dr.Zheng's team.