This work is licensed under a Creative Commons Attribution 4.0 International License.
Viphi A
General Information
DCTPep ID DCTPep00288
Peptide Name Viphi A
Sequence GSIPCGESCVFIPCISSVIGCACKSKVCYKN
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Viola philippica
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| BGC-823 | Human papillomavirus-related endocervical adenocarcinoma | IC50=1.75±0.05µM | SRB assay | 48h | 1 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | IC50=15.5±0.06µM | MTT assay | 5h | 1 |
| MM96L | Melanoma | IC50=4.91±0.04µM | MTT assay | 5h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HFF-1: IC50=3.19±0.01µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00288
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C136H223N35O41S6
Absent amino acids DHLMQRTW
Theoretical pI 8.33
Acidic residues 1
Basic residues 3
Polar residues 16
Molecular weight (Average) 3196.84
Molecular weight (Monoisotopic) 3194.48
Common amino acids C
Net charge 2
Instability index (II) 32.47
Aliphatic index 81.61
Grand average of hydropathicity (GRAVY) 0.703
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.583, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.466, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 21723349
Title Isolation and characterization of cytotoxic cyclotides from Viola philippica
Doi 10.1016/j.peptides.2011.06.016
Year 2011
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4487
This work is licensed under a Creative Commons Attribution 4.0 International License.