Peptide Libraray

Viphi D

General Information

DCTPep ID DCTPep00290

Peptide Name Viphi D

Sequence GIPCGESCVFIPCISSVIGCSCSSKVCYRN

Sequence Length 30

UniProt ID Not available

PubChem CID Not available

Origin Viola philippica

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
MM96L	Melanoma	IC50=2.51±0.03µM	MTT assay	5h	1
HeLa	Human papillomavirus-related endocervical adenocarcinoma	IC50=5.24±0.40µM	MTT assay	5h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity HFF-1: IC50=1.55±0.11µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00290

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C130H211N35O41S6

Absent amino acids ADHLMQTW

Theoretical pI 7.77

Acidic residues 1

Basic residues 2

Polar residues 17

Molecular weight (Average) 3112.68

Molecular weight (Monoisotopic) 3110.38

Common amino acids CS

Net charge 1

Instability index (II) 31.5

Aliphatic index 81.00

Grand average of hydropathicity (GRAVY) 0.750

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.599, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.479, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 21723349

Title Isolation and characterization of cytotoxic cyclotides from Viola philippica

Doi 10.1016/j.peptides.2011.06.016

Year 2011

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID DBAASPR_4488