Viphi E

General Information


DCTPep ID  DCTPep00291

Peptide Name   Viphi E

Sequence  GSIPCGESCVFIPCISAVIGCSCSNKVCYKN

Sequence Length  31

UniProt ID  Not available

PubChem CID  Not available

Origin  Viola philippica

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
MM96L Melanoma IC50=2.51±0.03µM MTT assay 5h 1
HeLa Human papillomavirus-related endocervical adenocarcinoma IC50=5.24±0.40µM MTT assay 5h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  HFF-1: IC50=1.55±0.09µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00291

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C134H217N35O42S6

Absent amino acids  DHLMQRTW

Theoretical pI  7.77

Acidic residues  1

Basic residues  2

Polar residues  17

Molecular weight (Average)  3182.77

Molecular weight (Monoisotopic)  3180.42

Common amino acids  C

Net charge  1

Instability index (II)  30.24

Aliphatic index  81.61

Grand average of hydropathicity (GRAVY)  0.716

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 1865
  Abs 0.1% (=1 g/l) 0.586, assuming all pairs of Cys residues form cystines
  Ext. coefficient 1490
  Abs 0.1% (=1 g/l) 0.468, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 21723349

Title  Isolation and characterization of cytotoxic cyclotides from Viola philippica

Doi 10.1016/j.peptides.2011.06.016

Year  2011

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DBAASP ID  DBAASPR_4489

DCTPep is developed by Dr.Zheng's team.