Peptide Libraray

Viphi E

General Information

DCTPep ID DCTPep00291

Peptide Name Viphi E

Sequence GSIPCGESCVFIPCISAVIGCSCSNKVCYKN

Sequence Length 31

UniProt ID Not available

PubChem CID Not available

Origin Viola philippica

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
MM96L	Melanoma	IC50=2.51±0.03µM	MTT assay	5h	1
HeLa	Human papillomavirus-related endocervical adenocarcinoma	IC50=5.24±0.40µM	MTT assay	5h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity HFF-1: IC50=1.55±0.09µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00291

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C134H217N35O42S6

Absent amino acids DHLMQRTW

Theoretical pI 7.77

Acidic residues 1

Basic residues 2

Polar residues 17

Molecular weight (Average) 3182.77

Molecular weight (Monoisotopic) 3180.42

Common amino acids C

Net charge 1

Instability index (II) 30.24

Aliphatic index 81.61

Grand average of hydropathicity (GRAVY) 0.716

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.586, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.468, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 21723349

Title Isolation and characterization of cytotoxic cyclotides from Viola philippica

Doi 10.1016/j.peptides.2011.06.016

Year 2011

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available

External Code

DBAASP ID DBAASPR_4489