This work is licensed under a Creative Commons Attribution 4.0 International License.
Pardaxin
General Information
DCTPep ID DCTPep00334
Peptide Name Pardaxin
Sequence GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
Sequence Length 33
UniProt ID P81861
PubChem CID Not available
Origin Red Sea Mosessole
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | ~70% Cytotoxicity=25 mg/L | MTS assay | 6 h | 2 |
| HT-1080 | Fibrosarcoma | ~90% Cytotoxicity=25 mg/L | MTS assay | 6 h | 2 |
| HT-1080 | Fibrosarcoma | IC50=14.51 µg/ml | MTS assay | 12 h | 1 |
| HT-1080 | Fibrosarcoma | IC50=14.52 µg/ml | MTS assay | 24 h | 1 |
| HT-1080 | Fibrosarcoma | IC50=15.40 µg/ml | MTS assay | 6 h | 1 |
| HT-1080 | Fibrosarcoma | IC50=15.74 µg/ml | MTS assay | 3 h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism pardaxin disrupted mitochondrial function and caused an accumulation of ROS that activated a caspase-dependent intrinsic apoptotic pathway
Structure Information
PDB ID 1XC0
Predicted Structure DCTPep00334
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C154H248N36O45
Absent amino acids CDHMNRWY
Theoretical pI 8.59
Acidic residues 1
Basic residues 2
Polar residues 12
Molecular weight (Average) 3323.88
Molecular weight (Monoisotopic) 3321.82
Common amino acids S
Net charge 1
Instability index (II) 39.52
Aliphatic index 112.42
Grand average of hydropathicity (GRAVY) 0.745
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22073006
Title Pardaxin, an antimicrobial peptide, triggers caspase-dependent and ROS-mediated apoptosis in HT-1080 cells
Year 2011
Literature 2
Pubmed ID 23598079
Title Truncated antimicrobial peptides from marine organisms retain anticancer activity and antibacterial activity against multidrug-resistant Staphylococcus aureus
Doi 10.1016/j.peptides.2013.04.004
Year 2013
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.