This work is licensed under a Creative Commons Attribution 4.0 International License.
Chassatide C2
General Information
DCTPep ID DCTPep00397
Peptide Name Chassatide C2
Sequence GIPCAESCVWIPCTITALMGCSCKNNVCYNN
Sequence Length 31
UniProt ID I0B6F2
PubChem CID Not available
Origin Chassalia chartacea
Type Native peptide
Classification
ACP Tumor active peptide Membrane-targeted
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | IC50=2.4 μM | MTT assay | Not available | 1 |
Hemolytic Activity Human erythrocytes: HD50>25 μM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00397
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys21; Cys8<--->Cys23; Cys13<--->Cys28; NCB: Gly1<--->Asn31
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C138H219N37O43S7
Absent amino acids DFHQR
Theoretical pI 5.96
Acidic residues 1
Basic residues 1
Polar residues 17
Molecular weight (Average) 3308.9
Molecular weight (Monoisotopic) 3306.41
Common amino acids C
Net charge 0
Instability index (II) 35.55
Aliphatic index 75.48
Grand average of hydropathicity (GRAVY) 0.503
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.226, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.112, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 22467870
Title Novel cyclotides and uncyclotides with highly shortened precursors from Chassalia chartacea and effects of methionine oxidation on bioactivities
Year 2012
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
External Code
DBAASP ID DBAASPR_4283
This work is licensed under a Creative Commons Attribution 4.0 International License.