Peptide Libraray

APTSTAT3-9R

General Information

DCTPep ID DCTPep00492

Peptide Name APTSTAT3-9R

Sequence HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR

Sequence Length 40

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

ACP Tumor active peptide Cancer targeted peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
A549	Lung adenocarcinoma	IC50=10-20 μmol/L	MTT assay	12h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target STAT3

Affinity Not available

Mechanism With the addition of a cell-penetrating motif, the resulting APTSTAT3-9R aptide was able to suppress the viability and proliferation of cancer cells by blocking STAT3 phosphorylation, thereby inhibiting STAT3 downstream signaling.

Structure Information

PDB ID Not available

Predicted Structure DCTPep00492

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C223H330N80O51

Absent amino acids CDIMV

Theoretical pI 12.31

Acidic residues 1

Basic residues 13

Polar residues 14

Molecular weight (Average) 4947.58

Molecular weight (Monoisotopic) 4944.57

Common amino acids R

Net charge 12

Instability index (II) 104.5

Aliphatic index 12.25

Grand average of hydropathicity (GRAVY) -1.795

Half Life
3.5 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 28990
Abs 0.1% (=1 g/l) 5.859

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 24576829

Title A Specific STAT3-Binding Peptide Exerts Antiproliferative Effects and Antitumor Activity by Inhibiting STAT3 Phosphorylation and Signaling

Doi 10.1158/0008-5472.CAN-13-2187

Year 2014

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available