Toxin F-VIII
General Information
DCTPep ID DCTPep00507
Peptide Name Toxin F-VIII
Sequence MICYSHKTPQPSATITCEEKTCYKKSVRKLPAIVAGRGCGCPSKEMLVAIHCCRSDKCNE
Sequence Length 60
UniProt ID P01404
PubChem CID Not available
Origin venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | LC50=106±5 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| HT-29 | Colon adenocarcinoma | LC50>300 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| MDA-MB-231 | Breast adenocarcinoma | LC50>300 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: LC50>1000 μg/mL
Normal (non-cancerous) Cytotoxicity HUVEC: LC50>300 μg/mL
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00507
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C277H462N82O84S10
Absent amino acids FW
Theoretical pI 8.87
Acidic residues 5
Basic residues 12
Polar residues 23
Molecular weight (Average) 6605.81
Molecular weight (Monoisotopic) 6601.16
Common amino acids CK
Net charge 7
Instability index (II) 45.4
Aliphatic index 60.17
Grand average of hydropathicity (GRAVY) -0.325
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3480
Abs 0.1% (=1 g/l) 0.527, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.451, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25035794
Title Peptides with in vitro anti-tumor activity from the venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available