This work is licensed under a Creative Commons Attribution 4.0 International License.
Toxin C13S1C1
General Information
DCTPep ID DCTPep00508
Peptide Name Toxin C13S1C1
Sequence RICYSHKLLQAKTTKTCEENSCYKRSLPKIPLIIIGRGCGCPLTLPFLRIKCCTSDKCN
Sequence Length 59
UniProt ID P18329
PubChem CID Not available
Origin venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HT-29 | Colon adenocarcinoma | LC50=110±4 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| A549 | Lung adenocarcinoma | LC50=56±4 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
| MDA-MB-231 | Breast adenocarcinoma | LC50=62±2 μg/mL | CellTiter-Glo Lumines- cent Cell Viability assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: LC50>600 μg/mL
Normal (non-cancerous) Cytotoxicity HUVEC: LC50=57±3 μg/mL
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00508
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C289H487N83O80S8
Absent amino acids MVW
Theoretical pI 9.33
Acidic residues 3
Basic residues 12
Polar residues 24
Molecular weight (Average) 6661.03
Molecular weight (Monoisotopic) 6656.44
Common amino acids CKL
Net charge 9
Instability index (II) 57.56
Aliphatic index 87.63
Grand average of hydropathicity (GRAVY) -0.139
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3480
Abs 0.1% (=1 g/l) 0.522, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.447, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 25035794
Title Peptides with in vitro anti-tumor activity from the venom of the Eastern green mamba, Dendroaspis angusticeps (Elapidae)
Doi Not available
Year 2014
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.