DC1
General Information
DCTPep ID DCTPep00549
Peptide Name DC1
Sequence GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Hedyotis diffusa
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| PC-3 | Prostate carcinoma | IC50=2.24 μM | CCK-8 assay | 72h | 1 |
| DU145 | Prostate carcinoma | IC50=3.32 μM | CCK-8 assay | 72h | 1 |
| LNCaP | Prostate carcinoma | IC50=5.03 μM | CCK-8 assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Structure Information
PDB ID Not available
Predicted Structure DCTPep00549
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C144H228N38O46S6
Absent amino acids HIMW
Theoretical pI 6.03
Acidic residues 2
Basic residues 2
Polar residues 17
Molecular weight (Average) 3419.98
Molecular weight (Monoisotopic) 3417.5
Common amino acids C
Net charge 0
Instability index (II) 23.09
Aliphatic index 75.94
Grand average of hydropathicity (GRAVY) 0.506
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.981, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.871, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 26064310
Title Novel cyclotides from Hedyotis diffusa induce apoptosis and inhibit proliferation and migration of prostate cancer cells
Doi Not available
Year 2015
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available