Peptide Libraray

DC3

General Information

DCTPep ID DCTPep00551

Peptide Name DC3

Sequence GTSCGETCVLLPCLSSVLGCTCQNKRCYKD

Sequence Length 30

UniProt ID Not available

PubChem CID Not available

Origin Hedyotis diffusa

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
LNCaP	Prostate carcinoma	IC50=0.21 μM	CCK-8 assay	72h	1
DU145	Prostate carcinoma	IC50=0.55 μM	CCK-8 assay	72h	1
PC-3	Prostate carcinoma	IC50=0.76 μM	CCK-8 assay	72h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism induce apoptosis and inhibit proliferation and migration of prostate cancer cells

Structure Information

PDB ID Not available

Predicted Structure DCTPep00551

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C129H217N37O44S6

Absent amino acids AFHIMW

Theoretical pI 7.77

Acidic residues 2

Basic residues 3

Polar residues 17

Molecular weight (Average) 3182.72

Molecular weight (Monoisotopic) 3180.42

Common amino acids C

Net charge 1

Instability index (II) 56.54

Aliphatic index 71.33

Grand average of hydropathicity (GRAVY) 0.123

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.586, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.468, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 26064310

Title Novel cyclotides from Hedyotis diffusa induce apoptosis and inhibit proliferation and migration of prostate cancer cells

Doi Not available

Year 2015

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available