Peptide Libraray

Defensin AFP1 / Hs-AFP1

General Information

DCTPep ID DCTPep00567

Peptide Name Defensin AFP1 / Hs-AFP1

Sequence DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC

Sequence Length 54

UniProt ID Not available

PubChem CID Not available

Origin Heuchera sanguinea

Type Native peptide

Classification

Cancer therapy related peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HepG2	Hepatoblastoma	Not active up to 40 µM	Cell Proliferation Kit II (XTT) assay	24h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00567

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys6<--->Cys54; Cys17<--->Cys39; Cys23<--->Cys48; Cys27<--->Cys50

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C251H378N76O77S8

Absent amino acids IMN

Theoretical pI 8.49

Acidic residues 4

Basic residues 10

Polar residues 24

Molecular weight (Average) 5948.71

Molecular weight (Monoisotopic) 5944.58

Common amino acids CS

Net charge 6

Instability index (II) 57.07

Aliphatic index 27.04

Grand average of hydropathicity (GRAVY) -0.613

Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 8980
Abs 0.1% (=1 g/l) 1.510, assuming all pairs of Cys residues form cystines
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 1.426, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 26248029

Title Synergistic Activity of the Plant Defensin HsAFP1 and Caspofungin against Candida albicans Biofilms and Planktonic Cultures

Doi 10.1371/journal.pone.0132701

Year 2015

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available