This work is licensed under a Creative Commons Attribution 4.0 International License.
PaDef defensin
General Information
DCTPep ID DCTPep00603
Peptide Name PaDef defensin
Sequence ATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Plant defensins
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| MCF-7 | Invasive breast carcinoma of no special type | IC 50=141.62 μg/mL | Trypan blue assay | 48h | 1 |
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | IC50=97.3 μg/mL (18.65 μM) | MTT assay | 24h | 2 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism PaDef defensin from avocado (Persea americana) fruit is cytotoxic to MCF-7 cells via the induction of mitochondrial apoptosis
Structure Information
PDB ID Not available
Predicted Structure DCTPep00603
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C210H341N73O64S9
Absent amino acids WY
Theoretical pI 8.77
Acidic residues 3
Basic residues 10
Polar residues 21
Molecular weight (Average) 5201.01
Molecular weight (Monoisotopic) 5197.32
Common amino acids C
Net charge 7
Instability index (II) 49.42
Aliphatic index 41.49
Grand average of hydropathicity (GRAVY) -0.413
Half Life
4.4 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 500
Abs 0.1% (=1 g/l) 0.096, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27470405
Title The defensin from avocado (Persea americana var. drymifolia) PaDef induces apoptosis in the human breast cancer cell line MCF-7
Doi 10.1016/j.biopha.2016.05.048
Year 2016
Literature 2
Pubmed ID 29559362
Title PaDef defensin from avocado (Persea americana var. drymifolia) is cytotoxic to K562 chronic myeloid leukemia cells through extrinsic apoptosis
Doi 10.1016/j.biocel.2018.03.013
Year 2018
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.