Peptide Libraray

CecXJ-37N

General Information

DCTPep ID DCTPep00615

Peptide Name CecXJ-37N

Sequence RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

Sequence Length 37

UniProt ID Not available

PubChem CID Not available

Origin Bombyx mori

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
Eca 109	Esophageal squamous cell carcinoma; Squamous cell carcinoma of the esophagus	30% Killing=20µM	MTT assay	24h	1

Hemolytic Activity Human erythrocytes: 5% Hemolysis=134.6µg/ml

Normal (non-cancerous) Cytotoxicity NIH 3T3: Not active up to 20 µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00615

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C185H317N55O46S1

Absent amino acids CHQTY

Theoretical pI 10.71

Acidic residues 3

Basic residues 10

Polar residues 7

Molecular weight (Average) 4079.95

Molecular weight (Monoisotopic) 4077.39

Common amino acids K

Net charge 7

Instability index (II) 61.88

Aliphatic index 100.27

Grand average of hydropathicity (GRAVY) -0.243

Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.348

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 27664674

Title A potential food biopreservative, CecXJ-37N, non-covalently intercalates into the nucleotides of bacterial genomic DNA beyond membrane attack

Doi 10.1016/j.foodchem.2016.09.033

Year 2017

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available