CecXJ-37N

General Information


DCTPep ID  DCTPep00615

Peptide Name   CecXJ-37N

Sequence  RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK

Sequence Length  37

UniProt ID  Not available

PubChem CID  Not available

Origin  Bombyx mori

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
Eca 109 Esophageal squamous cell carcinoma; Squamous cell carcinoma of the esophagus 30% Killing=20µM MTT assay 24h 1

Hemolytic Activity  Human erythrocytes: 5% Hemolysis=134.6µg/ml

Normal (non-cancerous) Cytotoxicity  NIH 3T3: Not active up to 20 µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00615

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C185H317N55O46S1

Absent amino acids  CHQTY

Theoretical pI  10.71

Acidic residues  3

Basic residues  10

Polar residues  7

Molecular weight (Average)  4079.95

Molecular weight (Monoisotopic)  4077.39

Common amino acids  K

Net charge  7

Instability index (II)  61.88

Aliphatic index  100.27

Grand average of hydropathicity (GRAVY)  -0.243

Half Life 
  1 hours (mammalian reticulocytes, in vitro).
  2 min (yeast, in vivo).
  2 min (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.348

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 27664674

Title  A potential food biopreservative, CecXJ-37N, non-covalently intercalates into the nucleotides of bacterial genomic DNA beyond membrane attack

Doi 10.1016/j.foodchem.2016.09.033

Year  2017

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.