This work is licensed under a Creative Commons Attribution 4.0 International License.
Saha-CATH3
General Information
DCTPep ID DCTPep00620
Peptide Name Saha-CATH3
Sequence KRMGIFHLFWAGLRKLGNLIKNKIQQGIENFLG
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Sarcophilus harrisii
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Not active up to 500 µg/ml | Alamar blue assay | 24h | 1 |
Hemolytic Activity Human erythrocytes:5% Hemolysis=1-500µg/ml
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00620
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C179H287N51O41S1
Absent amino acids CDPSTVY
Theoretical pI 11.17
Acidic residues 1
Basic residues 7
Polar residues 8
Molecular weight (Average) 3841.62
Molecular weight (Monoisotopic) 3839.17
Common amino acids GL
Net charge 6
Instability index (II) 27.19
Aliphatic index 109.39
Grand average of hydropathicity (GRAVY) -0.079
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.432
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27725697
Title Cathelicidins in the Tasmanian devil (Sarcophilus harrisii)
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.