This work is licensed under a Creative Commons Attribution 4.0 International License.
MCo-PEDF
General Information
DCTPep ID DCTPep00626
Peptide Name MCo-PEDF
Sequence CPKILKKCRRDSDCPGACICRGNGYCYHLNQPF
Sequence Length 33
UniProt ID P82409
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide Cancer targeted peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HT-29 | Colon adenocarcinoma | IC50=35.22±0.08 μM | MTT assay | 48h | 1 |
| PC-3 | Prostate carcinoma | IC50=39.11±0.07 μM | MTT assay | 48h | 1 |
| MCF-7 | Invasive breast carcinoma of no special type | IC50=53.44±0.14 μM | MTT assay | 48h | 1 |
Hemolytic Activity Human red blood cells: no hemolytic activity(as show in Fig.4)
Normal (non-cancerous) Cytotoxicity HUVEC: IC50=50.16±0.15 μM
Target pigment epithelium-derived factor; somatostatin
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00626
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C159H252N50O44S6
Absent amino acids EMTVW
Theoretical pI 8.90
Acidic residues 2
Basic residues 7
Polar residues 14
Molecular weight (Average) 3760.42
Molecular weight (Monoisotopic) 3757.73
Common amino acids C
Net charge 5
Instability index (II) 56.85
Aliphatic index 50.30
Grand average of hydropathicity (GRAVY) -0.579
Half Life
1.2 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.892, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.792, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 27734947
Title Dual-targeting anti-angiogenic cyclic peptides as potential drug leads for cancer therapy
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.