MCo-PEDF

General Information


DCTPep ID  DCTPep00626

Peptide Name   MCo-PEDF

Sequence  CPKILKKCRRDSDCPGACICRGNGYCYHLNQPF

Sequence Length  33

UniProt ID  P82409 

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

ACP Tumor active peptide Cancer targeted peptides



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
HT-29 Colon adenocarcinoma IC50=35.22±0.08 μM MTT assay 48h 1
PC-3 Prostate carcinoma IC50=39.11±0.07 μM MTT assay 48h 1
MCF-7 Invasive breast carcinoma of no special type IC50=53.44±0.14 μM MTT assay 48h 1

Hemolytic Activity  Human red blood cells: no hemolytic activity(as show in Fig.4)

Normal (non-cancerous) Cytotoxicity  HUVEC: IC50=50.16±0.15 μM

Target  pigment epithelium-derived factor; somatostatin

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00626

(Please note that there is the predicted structure, predicted by AlphaFold)

Sequence of
1    ​C​​P​​K​​I​​L​​K​​K​​C​​R​​R​11   ​D​​S​​D​​C​​P​​G​​A​​C​​I​​C​21   ​R​​G​​N​​G​​Y​​C​​Y​​H​​L​​N​31   ​Q​​P​​F​

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C159H252N50O44S6

Absent amino acids  EMTVW

Theoretical pI  8.90

Acidic residues  2

Basic residues  7

Polar residues  14

Molecular weight (Average)  3760.42

Molecular weight (Monoisotopic)  3757.73

Common amino acids  C

Net charge  5

Instability index (II)  56.85

Aliphatic index  50.30

Grand average of hydropathicity (GRAVY)  -0.579

Half Life 
  1.2 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 3355
  Abs 0.1% (=1 g/l) 0.892, assuming all pairs of Cys residues form cystines
  Ext. coefficient 2980
  Abs 0.1% (=1 g/l) 0.792, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 27734947

Title  Dual-targeting anti-angiogenic cyclic peptides as potential drug leads for cancer therapy

Doi 10.1038/srep35347

Year  2016

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.