Cyclotide cter-E
General Information
DCTPep ID DCTPep00744
Peptide Name Cyclotide cter-E
Sequence GIPCAESCVWIPCTVTALLGCSCKDKVCYLD
Sequence Length 31
UniProt ID Not available
PubChem CID Not available
Origin Clitoria ternatea
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| U-937/GTB | Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia | IC50=2.5µM | FMCA assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00744
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys21; Cys5<--->Cys23; Cys13<--->Cys28; NCB: Gly1<--->Asp31
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C142H228N34O43S6
Absent amino acids FHMNQR
Theoretical pI 4.56
Acidic residues 3
Basic residues 2
Polar residues 13
Molecular weight (Average) 3291.93
Molecular weight (Monoisotopic) 3289.5
Common amino acids C
Net charge -1
Instability index (II) 27.33
Aliphatic index 97.42
Grand average of hydropathicity (GRAVY) 0.777
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.237, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.123, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28669767
Title Bactericidal activity of cyclotides where phosphatidylethanolamine-lipid selectivity determines antimicrobial spectra
Doi 10.1016/j.bbamem.2017.06.018
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available