Cycloviolacin O3

General Information


DCTPep ID  DCTPep00745

Peptide Name   Cycloviolacin O3

Sequence  GIPCGESCVWIPCLTSAIGCSCKSKVCYRN

Sequence Length  30

UniProt ID  Not available

PubChem CID  Not available

Origin  Viola odorata

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
U-937/GTB Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia IC50=0.42µM FMCA assay 72h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00745

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C134H217N37O40S6

Absent amino acids  DFHMQ

Theoretical pI  8.33

Acidic residues  1

Basic residues  3

Polar residues  16

Molecular weight (Average)  3178.78

Molecular weight (Monoisotopic)  3176.44

Common amino acids  C

Net charge  2

Instability index (II)  25.08

Aliphatic index  74.67

Grand average of hydropathicity (GRAVY)  0.423

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7365
  Abs 0.1% (=1 g/l) 2.317, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 2.199, assuming all Cys residues are reduced

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 28669767

Title  Bactericidal activity of cyclotides where phosphatidylethanolamine-lipid selectivity determines antimicrobial spectra

Doi 10.1016/j.bbamem.2017.06.018

Year  2017

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.