Peptide Libraray

Cyclotide cter-G

General Information

DCTPep ID DCTPep00746

Peptide Name Cyclotide cter-G

Sequence GLPCGESCVFIPCITTVVGCSCKNKVCYNN

Sequence Length 30

UniProt ID Not available

PubChem CID Not available

Origin Clitoria ternatea

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
U-937/GTB	Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia	IC50=3µM	FMCA assay	72h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00746

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27; NCB: Gly1<--->Asn30

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C133H215N35O41S6

Absent amino acids ADHMQRW

Theoretical pI 7.77

Acidic residues 1

Basic residues 2

Polar residues 17

Molecular weight (Average) 3152.74

Molecular weight (Monoisotopic) 3150.41

Common amino acids C

Net charge 1

Instability index (II) 35.46

Aliphatic index 77.67

Grand average of hydropathicity (GRAVY) 0.563

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 1865
Abs 0.1% (=1 g/l) 0.592, assuming all pairs of Cys residues form cystines
Ext. coefficient 1490
Abs 0.1% (=1 g/l) 0.473, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 28669767

Title Bactericidal activity of cyclotides where phosphatidylethanolamine-lipid selectivity determines antimicrobial spectra

Doi 10.1016/j.bbamem.2017.06.018

Year 2017

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available