Peptide Libraray

Cycloviolacin-O19

General Information

DCTPep ID DCTPep00749

Peptide Name Cycloviolacin-O19

Sequence GTLPCGESCVWIPCISSVVGCSCKSKVCYKD

Sequence Length 31

UniProt ID Not available

PubChem CID Not available

Origin Viola odorata

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
U-937/GTB	Adult acute monocytic leukemia; Acute monoblastic/monocytic leukemia	IC50=0.52µM	FMCA assay	72h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00749

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys5<--->Cys21; Cys9<--->Cys23; Cys14<--->Cys28; NCB: Gly1<--->Asp31

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C138H223N35O43S6

Absent amino acids AFHMNQR

Theoretical pI 7.76

Acidic residues 2

Basic residues 3

Polar residues 16

Molecular weight (Average) 3252.86

Molecular weight (Monoisotopic) 3250.47

Common amino acids C

Net charge 1

Instability index (II) 30.47

Aliphatic index 75.16

Grand average of hydropathicity (GRAVY) 0.471

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.264, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.149, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 28669767

Title Bactericidal activity of cyclotides where phosphatidylethanolamine-lipid selectivity determines antimicrobial spectra

Doi 10.1016/j.bbamem.2017.06.018

Year 2017

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available