LysAB2 P3
General Information
DCTPep ID DCTPep00785
Peptide Name LysAB2 P3
Sequence NPEKALEKLIAIQKAIKGMLNGWFTGVGFRRKR
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A549 | Lung adenocarcinoma | Not active up to 200 µm | MTT assay | 24h | 1 |
Hemolytic Activity Human erythrocytes: 1.97% Hemolysis=4µM; <10% Hemolysis=256µM
Normal (non-cancerous) Cytotoxicity HaCat: Not active up to 200 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00785
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C172H285N51O42S1
Absent amino acids CDHSY
Theoretical pI 11.12
Acidic residues 2
Basic residues 8
Polar residues 7
Molecular weight (Average) 3771.53
Molecular weight (Monoisotopic) 3769.15
Common amino acids K
Net charge 6
Instability index (II) 27.65
Aliphatic index 88.79
Grand average of hydropathicity (GRAVY) -0.403
Half Life
1.4 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.458
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28904355
Title Highly potent antimicrobial modified peptides derived from the Acinetobacter baumannii phage endolysin LysAB2
Doi 10.1038/s41598-017-11832-7
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available