Peptide Libraray

LysAB2 P3

General Information

DCTPep ID DCTPep00785

Peptide Name LysAB2 P3

Sequence NPEKALEKLIAIQKAIKGMLNGWFTGVGFRRKR

Sequence Length 33

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
A549	Lung adenocarcinoma	Not active up to 200 µm	MTT assay	24h	1

Hemolytic Activity Human erythrocytes: 1.97% Hemolysis=4µM; <10% Hemolysis=256µM

Normal (non-cancerous) Cytotoxicity HaCat: Not active up to 200 µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00785

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C172H285N51O42S1

Absent amino acids CDHSY

Theoretical pI 11.12

Acidic residues 2

Basic residues 8

Polar residues 7

Molecular weight (Average) 3771.53

Molecular weight (Monoisotopic) 3769.15

Common amino acids K

Net charge 6

Instability index (II) 27.65

Aliphatic index 88.79

Grand average of hydropathicity (GRAVY) -0.403

Half Life
1.4 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.458

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 28904355

Title Highly potent antimicrobial modified peptides derived from the Acinetobacter baumannii phage endolysin LysAB2

Doi 10.1038/s41598-017-11832-7

Year 2017

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available