LysAB2 P3

General Information


DCTPep ID  DCTPep00785

Peptide Name   LysAB2 P3

Sequence  NPEKALEKLIAIQKAIKGMLNGWFTGVGFRRKR

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Synthetic

Type  Synthetic peptide

Classification

  

Cancer therapy related peptides



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
A549 Lung adenocarcinoma Not active up to 200 µm MTT assay 24h 1

Hemolytic Activity  Human erythrocytes: 1.97% Hemolysis=4µM; <10% Hemolysis=256µM

Normal (non-cancerous) Cytotoxicity  HaCat: Not active up to 200 µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  DCTPep00785

(Please note that there is the predicted structure, predicted by AlphaFold)

Parsing response... [0/0]
SequenceNo structure available

Helicity  Not available

Linear/Cyclic  Linear

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L



Physicochemical Information


Formula  C172H285N51O42S1

Absent amino acids  CDHSY

Theoretical pI  11.12

Acidic residues  2

Basic residues  8

Polar residues  7

Molecular weight (Average)  3771.53

Molecular weight (Monoisotopic)  3769.15

Common amino acids  K

Net charge  6

Instability index (II)  27.65

Aliphatic index  88.79

Grand average of hydropathicity (GRAVY)  -0.403

Half Life 
  1.4 hours (mammalian reticulocytes, in vitro).
  3 min (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 5500
  Abs 0.1% (=1 g/l) 1.458

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 28904355

Title  Highly potent antimicrobial modified peptides derived from the Acinetobacter baumannii phage endolysin LysAB2

Doi 10.1038/s41598-017-11832-7

Year  2017

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.