LfcinB (17-31)4
General Information
DCTPep ID DCTPep00787
Peptide Name LfcinB (17-31)4
Sequence FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC
Sequence Length 33
UniProt ID Not available
PubChem CID Not available
Origin Bovine Lactoferricin
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
Cell Line | Disease | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|
MDA-MB-468 | Breast adenocarcinoma | IC50=5 μM | MTT assay | 2h | 1 |
MDA-MB-231 | Breast adenocarcinoma | IC50=9 μM | MTT assay | 2h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Tetrameric
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification X=Ahx
Chiral L
Physicochemical Information
Formula Not Applicable
Absent amino acids Not Applicable
Theoretical pI Not Applicable
Acidic residues Not Applicable
Basic residues Not Applicable
Polar residues Not Applicable
Molecular weight (Average) Not Applicable
Molecular weight (Monoisotopic) Not Applicable
Common amino acids Not Applicable
Net charge Not Applicable
Instability index (II) Not Applicable
Aliphatic index Not Applicable
Grand average of hydropathicity (GRAVY) Not Applicable
Half Life
Not Applicable
Extinction coefficients
Not Applicable
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 28961215
Title Antibacterial Synthetic Peptides Derived from Bovine Lactoferricin Exhibit Cytotoxic Effect against MDA-MB-468 and MDA-MB-231 Breast Cancer Cell Lines
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available