LfcinB (17-31)4

General Information


DCTPep ID  DCTPep00787

Peptide Name   LfcinB (17-31)4

Sequence  FKARRWQWRMKKLGAFKARRWQWRMKKLGAKXC

Sequence Length  33

UniProt ID  Not available

PubChem CID  Not available

Origin  Bovine Lactoferricin

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
MDA-MB-468 Breast adenocarcinoma IC50=5 μM MTT assay 2h 1
MDA-MB-231 Breast adenocarcinoma IC50=9 μM MTT assay 2h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Tetrameric

Disulfide/Other Bond  Not available

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  X=Ahx

Chiral  L



Physicochemical Information


Formula  Not Applicable

Absent amino acids  Not Applicable

Theoretical pI  Not Applicable

Acidic residues  Not Applicable

Basic residues  Not Applicable

Polar residues  Not Applicable

Molecular weight (Average)  Not Applicable

Molecular weight (Monoisotopic)  Not Applicable

Common amino acids  Not Applicable

Net charge  Not Applicable

Instability index (II)  Not Applicable

Aliphatic index  Not Applicable

Grand average of hydropathicity (GRAVY)  Not Applicable

Half Life 
  Not Applicable

Extinction coefficients 
  Not Applicable

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 28961215

Title  Antibacterial Synthetic Peptides Derived from Bovine Lactoferricin Exhibit Cytotoxic Effect against MDA-MB-468 and MDA-MB-231 Breast Cancer Cell Lines

Doi 10.3390/molecules22101641

Year  2017

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.