This work is licensed under a Creative Commons Attribution 4.0 International License.
Em-Pis1
General Information
DCTPep ID DCTPep00827
Peptide Name Em-Pis1
Sequence FIFHIIKGLFHAGKMIHGLVTRRRHGVEELQDLDQRAFEREKAFA
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Epinephelus coioides; Epinephelus malabaricus
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| N2a | Mouse neuroblastoma cells | 65.6% Killing=20µM | CCK-8 assay | 72h | 1 |
| A549 | Lung adenocarcinoma | 73.5% Killing=20µM | CCK-8 assay | 72h | 1 |
Hemolytic Activity Fish erythrocytes:25% Hemolysis=20µM; Rabbit erythrocytes:47% Hemolysis=20µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00827
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C242H379N73O61S1
Absent amino acids CNPSWY
Theoretical pI 9.69
Acidic residues 6
Basic residues 12
Polar residues 5
Molecular weight (Average) 5319.18
Molecular weight (Monoisotopic) 5315.85
Common amino acids FR
Net charge 6
Instability index (II) 65.88
Aliphatic index 91.11
Grand average of hydropathicity (GRAVY) -0.280
Half Life
1.1 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Should not be visible by UV spectrophotometry.
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30032476
Title EmPis-1L, an Effective Antimicrobial Peptide Against the Antibiotic-Resistant VBNC State Cells of Pathogenic Bacteria
Year 2019
Literature 2
Pubmed ID 27554395
Title Two isoforms of piscidin from Malabar grouper, Epinephelus malabaricus: Expression and functional characterization
Year 2016
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.