This work is licensed under a Creative Commons Attribution 4.0 International License.
PACAP
General Information
DCTPep ID DCTPep00851
Peptide Name PACAP
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGRRYRQRFRNK
Sequence Length 38
UniProt ID P48144
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| NCI-H460 | Lung large cell carcinoma | IC50=14.97 ± 1.16 µM | Crystal violet assay | 48h | 1 |
Hemolytic Activity Human red blood cells: PACAP was not hemolytic for human erythrocytes at concentrations below 75 μM (0% hemolysis). At concentration between 75 μM and 150 μM the hemolytic activity was less than 3%; Fish red blood cells:PACAP was not hemolytic for fish red blood cells at concentrations below 18.75 μM (0% hemolysis). At concentration between 18.75 μM and 150 μM, the hemolytic activity was less than 20%
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00851
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C207H330N68O54S1
Absent amino acids CEPW
Theoretical pI 11.03
Acidic residues 2
Basic residues 12
Polar residues 11
Molecular weight (Average) 4667.38
Molecular weight (Monoisotopic) 4664.49
Common amino acids R
Net charge 10
Instability index (II) 43.11
Aliphatic index 53.95
Grand average of hydropathicity (GRAVY) -1.145
Half Life
3.5 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5960
Abs 0.1% (=1 g/l) 1.277
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30481557
Title Evidence for antimicrobial and anticancer activity of pituitary adenylate cyclase-activating polypeptide (PACAP) from North African catfish (Clarias gariepinus): Its potential use as novel therapeutic agent in fish and humans
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.