This work is licensed under a Creative Commons Attribution 4.0 International License.
NoD173(Q22K)
General Information
DCTPep ID DCTPep00865
Peptide Name NoD173(Q22K)
Sequence RQCKAESNTFTGICIAKPPCRKACIREKFTDGHCSKVLRRCLCTKRC
Sequence Length 47
UniProt ID Not available
PubChem CID Not available
Origin Nicotiana occidentalis
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | IC50=0.70±0.07 μM | MTT assay | 48h | 1 |
| MM170 | Melanoma | IC50=0.87±0.04 μM | MTT assay | 48h | 1 |
| PC-3 | Prostate carcinoma | IC50=2.86±0.14 μM | MTT assay | 48h | 1 |
Hemolytic Activity Human red blood cells: with ∼12% lysis at the very high concentration (100 µM)
Normal (non-cancerous) Cytotoxicity HUVEC: IC50=6.20±0.07 μM; AHDF: IC50=6.49±0.13 μM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00865
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C223H381N75O62S8
Absent amino acids MWY
Theoretical pI 9.58
Acidic residues 3
Basic residues 13
Polar residues 17
Molecular weight (Average) 5361.42
Molecular weight (Monoisotopic) 5357.67
Common amino acids C
Net charge 10
Instability index (II) 56.27
Aliphatic index 54.04
Grand average of hydropathicity (GRAVY) -0.494
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 500
Abs 0.1% (=1 g/l) 0.093, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 30794440
Title Structural and functional characterization of the membrane-permeabilizing activity of Nicotiana occidentalis defensin NoD173 and protein engineering to enhance oncolysis
Year 2019
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.