This work is licensed under a Creative Commons Attribution 4.0 International License.
Turgencin B
General Information
DCTPep ID DCTPep00939
Peptide Name Turgencin B
Sequence GIKEMLCNMACAQTVCKKSGGPLCDTCQAACKALG
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synoicum turgens
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| A2058 | Amelanotic melanoma | IC50=4.1 µM | AqueousOne assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MRC-5: IC50=7.5 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00939
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification None
Chiral L
Physicochemical Information
Formula C143H248N42O46S8
Absent amino acids FHRWY
Theoretical pI 8.33
Acidic residues 2
Basic residues 4
Polar residues 14
Molecular weight (Average) 3548.28
Molecular weight (Monoisotopic) 3545.61
Common amino acids C
Net charge 2
Instability index (II) 36.08
Aliphatic index 67.14
Grand average of hydropathicity (GRAVY) 0.269
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 375
Abs 0.1% (=1 g/l) 0.106, assuming all pairs of Cys residues form cystines
Ext. coefficient 0
Abs 0.1% (=1 g/l) 0.000, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31940927
Title Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.