Turgencin B Mox1
General Information
DCTPep ID DCTPep00940
Peptide Name Turgencin B Mox1
Sequence GIKEXLCNMACAQTVCKKSGGPLCDTCQAACKALG
Sequence Length 35
UniProt ID Not available
PubChem CID Not available
Origin Synoicum turgens
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
Cell Line | Disease | Activity | Assay | Testing Time | Literature |
---|---|---|---|---|---|
A2058 | Amelanotic melanoma | IC50=27.4 µM | AqueousOne assay | 72h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity MRC-5: IC50> 50 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure Not available
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24
N-terminal Modification Free
C-terminal Modification Amidation
Other Modification X=MET-OXD
Chiral L
Physicochemical Information
Formula Not Applicable
Absent amino acids Not Applicable
Theoretical pI Not Applicable
Acidic residues Not Applicable
Basic residues Not Applicable
Polar residues Not Applicable
Molecular weight (Average) Not Applicable
Molecular weight (Monoisotopic) Not Applicable
Common amino acids Not Applicable
Net charge Not Applicable
Instability index (II) Not Applicable
Aliphatic index Not Applicable
Grand average of hydropathicity (GRAVY) Not Applicable
Half Life
Not Applicable
Extinction coefficients
Not Applicable
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 31940927
Title Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available