Peptide Libraray

Turgencin B Mox1

General Information

DCTPep ID DCTPep00940

Peptide Name Turgencin B Mox1

Sequence GIKEXLCNMACAQTVCKKSGGPLCDTCQAACKALG

Sequence Length 35

UniProt ID Not available

PubChem CID Not available

Origin Synoicum turgens

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
A2058	Amelanotic melanoma	IC50=27.4 µM	AqueousOne assay	72h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity MRC-5: IC50> 50 µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Cyclic

Disulfide/Other Bond Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification X=MET-OXD

Chiral L

Physicochemical Information

Formula Not Applicable

Absent amino acids Not Applicable

Theoretical pI Not Applicable

Acidic residues Not Applicable

Basic residues Not Applicable

Polar residues Not Applicable

Molecular weight (Average) Not Applicable

Molecular weight (Monoisotopic) Not Applicable

Common amino acids Not Applicable

Net charge Not Applicable

Instability index (II) Not Applicable

Aliphatic index Not Applicable

Grand average of hydropathicity (GRAVY) Not Applicable

Half Life
Not Applicable

Extinction coefficients
Not Applicable

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 31940927

Title Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens

Doi 10.3390/md18010051

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available