Turgencin B Mox1

General Information


DCTPep ID  DCTPep00940

Peptide Name   Turgencin B Mox1

Sequence  GIKEXLCNMACAQTVCKKSGGPLCDTCQAACKALG

Sequence Length  35

UniProt ID  Not available

PubChem CID  Not available

Origin  Synoicum turgens

Type  Native peptide

Classification

  

ACP Tumor active peptide



Activity Information


Cell Line Disease Activity Assay Testing Time Literature
A2058 Amelanotic melanoma IC50=27.4 µM AqueousOne assay 72h 1

Hemolytic Activity  Not available

Normal (non-cancerous) Cytotoxicity  MRC-5: IC50> 50 µM

Target  Not available

Affinity  Not available

Mechanism  Not available



Structure Information


PDB ID  Not available

Predicted Structure  Not available

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys7<--->Cys31; Cys11<--->Cys27; Cys16<--->Cys24

N-terminal Modification  Free

C-terminal Modification  Amidation

Other Modification  X=MET-OXD

Chiral  L



Physicochemical Information


Formula  Not Applicable

Absent amino acids  Not Applicable

Theoretical pI  Not Applicable

Acidic residues  Not Applicable

Basic residues  Not Applicable

Polar residues  Not Applicable

Molecular weight (Average)  Not Applicable

Molecular weight (Monoisotopic)  Not Applicable

Common amino acids  Not Applicable

Net charge  Not Applicable

Instability index (II)  Not Applicable

Aliphatic index  Not Applicable

Grand average of hydropathicity (GRAVY)  Not Applicable

Half Life 
  Not Applicable

Extinction coefficients 
  Not Applicable

Amino acid distribution



Literature Information


Literature 1

Pubmed ID 31940927

Title  Isolation and Characterization of Antimicrobial Peptides with Unusual Disulfide Connectivity from the Colonial Ascidian Synoicum turgens

Doi 10.3390/md18010051

Year  2020

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available




DCTPep is developed by Dr.Zheng's team.