This work is licensed under a Creative Commons Attribution 4.0 International License.
anti-HIV AMPs Molecule 3
General Information
DCTPep ID DCTPep00985
Peptide Name anti-HIV AMPs Molecule 3
Sequence RWKLFKKIEKVGRNVRDGLIKAGPAIAVIGQAKSLGK
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Bombyx mori
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | 20% Killing=100 µg/ml | MTT assay | 48h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity HEK293T: 40% Killing=100µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00985
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H318N56O45
Absent amino acids CHMTY
Theoretical pI 11.20
Acidic residues 2
Basic residues 10
Polar residues 7
Molecular weight (Average) 4046.91
Molecular weight (Monoisotopic) 4044.43
Common amino acids K
Net charge 8
Instability index (II) 27.8
Aliphatic index 108.11
Grand average of hydropathicity (GRAVY) -0.219
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.359
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32322274
Title Antibacterial Activity of Rationally Designed Antimicrobial Peptides
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.