This work is licensed under a Creative Commons Attribution 4.0 International License.
anti-HIV AMPs Molecule 7
General Information
DCTPep ID DCTPep00986
Peptide Name anti-HIV AMPs Molecule 7
Sequence RWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK
Sequence Length 37
UniProt ID Not available
PubChem CID Not available
Origin Bombyx mori
Type Native peptide
Classification
Cancer therapy related peptides
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | 10% Killing=20µM | MTT assay | 48h | 1 |
| Eca 109 | Esophageal squamous cell carcinoma; Squamous cell carcinoma of the esophagus | 20% Killing=100µg/ml | MTT assay | 24h | 2 |
Hemolytic Activity Human erythrocytes: 5% Hemolysis=77.5µg/ml
Normal (non-cancerous) Cytotoxicity NIH 3T3: Not active up to 20 µM; HEK293T: 37% Killing=100µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00986
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C185H317N55O46S1
Absent amino acids CHQTY
Theoretical pI 10.71
Acidic residues 3
Basic residues 10
Polar residues 7
Molecular weight (Average) 4079.95
Molecular weight (Monoisotopic) 4077.39
Common amino acids K
Net charge 7
Instability index (II) 61.88
Aliphatic index 100.27
Grand average of hydropathicity (GRAVY) -0.243
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.348
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32322274
Title Antibacterial Activity of Rationally Designed Antimicrobial Peptides
Year 2020
Literature 2
Pubmed ID 27664674
Title A potential food biopreservative, CecXJ-37N, non-covalently intercalates into the nucleotides of bacterial genomic DNA beyond membrane attack
Doi 10.1016/j.foodchem.2016.09.033
Year 2017
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.