Peptide Libraray

EtCec2-NH2

General Information

DCTPep ID DCTPep00989

Peptide Name EtCec2-NH2

Sequence GWLRDFGKRIERTGQNIRDATIQTIGIAQEAANVAATLK

Sequence Length 39

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HepG2	Hepatoblastoma	Not active up to 535 µg/ml	CellTiter-Glo ATP assay	24h	1

Hemolytic Activity Human erythrocytes: Not active up to 512 µg/ml

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00989

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Amidation

Other Modification None

Chiral L

Physicochemical Information

Formula C186H309N59O57

Absent amino acids CHMPSY

Theoretical pI 9.97

Acidic residues 4

Basic residues 6

Polar residues 10

Molecular weight (Average) 4283.86

Molecular weight (Monoisotopic) 4281.31

Common amino acids A

Net charge 2

Instability index (II) 46.2

Aliphatic index 92.82

Grand average of hydropathicity (GRAVY) -0.377

Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 5500
Abs 0.1% (=1 g/l) 1.284

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 32344933

Title Antimicrobial Peptides from Rat-Tailed Maggots of the Drone Fly Eristalis tenax Show Potent Activity against Multidrug-Resistant Gram-Negative Bacteria

Doi 10.3390/microorganisms8050626

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available