Peptide Libraray

EtDip

General Information

DCTPep ID DCTPep00990

Peptide Name EtDip

Sequence QFNMQGGGSPRQGFDVNANARFPIWQSQNARNSVHGTASYAQHLGGPYGNSRPNFGGGLQFT

Sequence Length 62

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

Cancer therapy related peptides

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HepG2	Hepatoblastoma	Not active up to 1330 µg/ml	CellTiter-Glo ATP assay	24h	1

Hemolytic Activity Human erythrocytes: Not active up to 1024 µg/ml

Normal (non-cancerous) Cytotoxicity Not available

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep00990

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C290H425N93O88S1

Absent amino acids CEK

Theoretical pI 10.83

Acidic residues 1

Basic residues 6

Polar residues 27

Molecular weight (Average) 6654.19

Molecular weight (Monoisotopic) 6650.14

Common amino acids G

Net charge 5

Instability index (II) 49.49

Aliphatic index 36.29

Grand average of hydropathicity (GRAVY) -0.826

Half Life
0.8 hours (mammalian reticulocytes, in vitro).
10 min (yeast, in vivo).
10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 8480
Abs 0.1% (=1 g/l) 1.274

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 32344933

Title Antimicrobial Peptides from Rat-Tailed Maggots of the Drone Fly Eristalis tenax Show Potent Activity against Multidrug-Resistant Gram-Negative Bacteria

Doi 10.3390/microorganisms8050626

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available