Hyen M
General Information
DCTPep ID DCTPep00995
Peptide Name Hyen M
Sequence SIPCAESCVWIPCTVTALLGCSCSDKVCYN
Sequence Length 30
UniProt ID C0HLP
PubChem CID Not available
Origin medicinal herb Hybanthus enneaspermus
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| K562 | Blast phase chronic myelogenous leukemia, BCR-ABL1 positive; Chronic myeloid leukemia | CC50=1.16±0.03 µM | Resazurin assay | 24h | 1 |
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | CC50=1.34±0.04 µM | Resazurin assay | 24h | 1 |
| MCF-7 | Invasive breast carcinoma of no special type | CC50=2.36±0.16 µM | Resazurin assay | 24h | 1 |
Hemolytic Activity Human red blood cells (hRBCs): HC50>50 µM
Normal (non-cancerous) Cytotoxicity HUVEC: CC50=1.38±0.03 µM, testing time is 24h
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep00995
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys20; Cys8<--->Cys22; Cys13<--->Cys27
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C134H213N33O43S6
Absent amino acids FHMQR
Theoretical pI 4.37
Acidic residues 2
Basic residues 1
Polar residues 15
Molecular weight (Average) 3166.72
Molecular weight (Monoisotopic) 3164.38
Common amino acids C
Net charge -1
Instability index (II) 30.74
Aliphatic index 87.67
Grand average of hydropathicity (GRAVY) 0.767
Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 2.326, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.207, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32414842
Title Discovery and mechanistic studies of cytotoxic cyclotides from the medicinal herb Hybanthus enneaspermus
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available