Brevinin-2SSb
General Information
DCTPep ID DCTPep01010
Peptide Name Brevinin-2SSb
Sequence SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS
Sequence Length 40
UniProt ID Not available
PubChem CID Not available
Origin Glandirana susurra
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HepG2 | Hepatoblastoma | 95.3% Killing=32µg/ml | MTT assay | 24h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity COS-7: 88.5% Killing=32µg/ml; CPAE: 99.2% Killing=32µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01010
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C199H319N53O56S2
Absent amino acids HRT
Theoretical pI 9.81
Acidic residues 2
Basic residues 7
Polar residues 13
Molecular weight (Average) 4414.16
Molecular weight (Monoisotopic) 4411.32
Common amino acids K
Net charge 5
Instability index (II) 33.91
Aliphatic index 70.75
Grand average of hydropathicity (GRAVY) -0.472
Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.584, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.584, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 32751229
Title Antimicrobial Property and Mode of Action of the Skin Peptides of the Sado Wrinkled Frog, Glandirana susurra, against Animal and Plant Pathogens
Doi 10.3390/antibiotics9080457
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available