Peptide Libraray

Brevinin-2SSb

General Information

DCTPep ID DCTPep01010

Peptide Name Brevinin-2SSb

Sequence SLFSLIKAGAKFLGKNMLKQGPQYPACKVSKDSENVNWKS

Sequence Length 40

UniProt ID Not available

PubChem CID Not available

Origin Glandirana susurra

Type Native peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
HepG2	Hepatoblastoma	95.3% Killing=32µg/ml	MTT assay	24h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity COS-7: 88.5% Killing=32µg/ml; CPAE: 99.2% Killing=32µg/ml

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01010

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C199H319N53O56S2

Absent amino acids HRT

Theoretical pI 9.81

Acidic residues 2

Basic residues 7

Polar residues 13

Molecular weight (Average) 4414.16

Molecular weight (Monoisotopic) 4411.32

Common amino acids K

Net charge 5

Instability index (II) 33.91

Aliphatic index 70.75

Grand average of hydropathicity (GRAVY) -0.472

Half Life
1.9 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.584, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 1.584, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 32751229

Title Antimicrobial Property and Mode of Action of the Skin Peptides of the Sado Wrinkled Frog, Glandirana susurra, against Animal and Plant Pathogens

Doi 10.3390/antibiotics9080457

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available