This work is licensed under a Creative Commons Attribution 4.0 International License.
Del1
General Information
DCTPep ID DCTPep01029
Peptide Name Del1
Sequence RRIPFWPIPLRWQWPPPWFPPSFPIPRISRKR
Sequence Length 32
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| MEC-1 | Chronic lymphocytic leukemia; B-cell chronic lymphocytic leukemia | 80% killing=32μM | MTT assay | 20h | 1 |
Hemolytic Activity Human erythrocytes:25% Hemolysis=32µM
Normal (non-cancerous) Cytotoxicity HaCat: 10% Killing=32µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01029
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C204H296N56O36
Absent amino acids ACDEGHMNTVY
Theoretical pI 12.70
Acidic residues 0
Basic residues 7
Polar residues 2
Molecular weight (Average) 4108.95
Molecular weight (Monoisotopic) 4106.31
Common amino acids P
Net charge 7
Instability index (II) 103.89
Aliphatic index 60.94
Grand average of hydropathicity (GRAVY) -0.794
Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 22000
Abs 0.1% (=1 g/l) 5.354
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 33036159
Title Characterization of Cetacean Proline-Rich Antimicrobial Peptides Displaying Activity against ESKAPE Pathogens
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.