Peptide Libraray

Cathelicidin Neo1

General Information

DCTPep ID DCTPep01031

Peptide Name Cathelicidin Neo1

Sequence RRIRFPFPPFPWQWPPAGFPTFHIPRIPRKQ

Sequence Length 31

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
MEC-1	Chronic lymphocytic leukemia; B-cell chronic lymphocytic leukemia	32% killing=32μM	MTT assay	20h	1

Hemolytic Activity Human erythrocytes:0% Hemolysis=32µM

Normal (non-cancerous) Cytotoxicity HaCat: 12% Killing=32µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01031

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C191H273N53O35

Absent amino acids CDELMNSVY

Theoretical pI 12.60

Acidic residues 0

Basic residues 7

Polar residues 2

Molecular weight (Average) 3871.6

Molecular weight (Monoisotopic) 3869.12

Common amino acids P

Net charge 7

Instability index (II) 102.21

Aliphatic index 40.97

Grand average of hydropathicity (GRAVY) -0.794

Half Life
1 hours (mammalian reticulocytes, in vitro).
2 min (yeast, in vivo).
2 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 11000
Abs 0.1% (=1 g/l) 2.841

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 33036159

Title Characterization of Cetacean Proline-Rich Antimicrobial Peptides Displaying Activity against ESKAPE Pathogens

Doi 10.3390/ijms21197367

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available