Peptide Libraray

Pom-1

General Information

DCTPep ID DCTPep01034

Peptide Name Pom-1

Sequence KCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQ

Sequence Length 34

UniProt ID Not available

PubChem CID Not available

Origin Synthetic

Type Synthetic peptide

Classification

ACP Tumor active peptide

Activity Information

Cell Line	Disease	Activity	Assay	Testing Time	Literature
TZM-bl	Human papillomavirus-related endocervical adenocarcinoma	IC50=40.16µg/ml	MTT assay	48h	1

Hemolytic Activity Not available

Normal (non-cancerous) Cytotoxicity Vero E6: 50% Cytotoxicity=438 µM

Target Not available

Affinity Not available

Mechanism Not available

Structure Information

PDB ID Not available

Predicted Structure DCTPep01034

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity Not available

Linear/Cyclic Linear

Disulfide/Other Bond Not available

N-terminal Modification Free

C-terminal Modification Free

Other Modification None

Chiral L

Physicochemical Information

Formula C161H265N41O41S1

Absent amino acids DHMNPRTV

Theoretical pI 9.75

Acidic residues 1

Basic residues 5

Polar residues 11

Molecular weight (Average) 3463.18

Molecular weight (Monoisotopic) 3460.96

Common amino acids G

Net charge 4

Instability index (II) 9.65

Aliphatic index 117.94

Grand average of hydropathicity (GRAVY) 0.556

Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).

Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.018, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.018, assuming all Cys residues are reduced

Amino acid distribution

Literature Information

Literature 1

Pubmed ID 33113998

Title New Antibacterial Peptides from the Freshwater Mollusk Pomacea poeyana (Pilsbry, 1927)

Doi 10.3390/biom10111473

Year 2020

Patent

Patent ID Not available

Patent Title Not available

Other Iinformation Not available

Other Published ID Not available