Pom-1
General Information
DCTPep ID DCTPep01034
Peptide Name Pom-1
Sequence KCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQ
Sequence Length 34
UniProt ID Not available
PubChem CID Not available
Origin Synthetic
Type Synthetic peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| TZM-bl | Human papillomavirus-related endocervical adenocarcinoma | IC50=40.16µg/ml | MTT assay | 48h | 1 |
Hemolytic Activity Not available
Normal (non-cancerous) Cytotoxicity Vero E6: 50% Cytotoxicity=438 µM
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01034
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Linear
Disulfide/Other Bond Not available
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C161H265N41O41S1
Absent amino acids DHMNPRTV
Theoretical pI 9.75
Acidic residues 1
Basic residues 5
Polar residues 11
Molecular weight (Average) 3463.18
Molecular weight (Monoisotopic) 3460.96
Common amino acids G
Net charge 4
Instability index (II) 9.65
Aliphatic index 117.94
Grand average of hydropathicity (GRAVY) 0.556
Half Life
1.3 hours (mammalian reticulocytes, in vitro).
3 min (yeast, in vivo).
3 min (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.018, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 2.018, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 33113998
Title New Antibacterial Peptides from the Freshwater Mollusk Pomacea poeyana (Pilsbry, 1927)
Year 2020
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available