This work is licensed under a Creative Commons Attribution 4.0 International License.
hBD-3(human beta-defensin-3)
General Information
DCTPep ID DCTPep01056
Peptide Name hBD-3(human beta-defensin-3)
Sequence GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Sequence Length 45
UniProt ID Not available
PubChem CID Not available
Origin Homo sapiens
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| HeLa | Human papillomavirus-related endocervical adenocarcinoma | 0% Killing=40 µg/ml | MTT assay | 2h | 1 |
| A549 | Lung adenocarcinoma | 30% Killing=40 µg/ml | MTT assay | 2h | 1 |
Hemolytic Activity Human erythrocytes: 0% Hemolysis=40 µg/ml
Normal (non-cancerous) Cytotoxicity Vero cells: 20% Killing=40 µg/ml
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01056
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys11<---Cys40; Cys18<--->Cys33; Cys23<---Cys41
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C216H377N75O59S6
Absent amino acids DFHMW
Theoretical pI 10.08
Acidic residues 2
Basic residues 13
Polar residues 18
Molecular weight (Average) 5161.2
Molecular weight (Monoisotopic) 5157.71
Common amino acids R
Net charge 11
Instability index (II) 53.13
Aliphatic index 67.11
Grand average of hydropathicity (GRAVY) -0.700
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 3355
Abs 0.1% (=1 g/l) 0.650, assuming all pairs of Cys residues form cystines
Ext. coefficient 2980
Abs 0.1% (=1 g/l) 0.577, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 34025617
Title A Chimeric Cationic Peptide Composed of Human β-Defensin 3 and Human β-Defensin 4 Exhibits Improved Antibacterial Activity and Salt Resistance
Year 2021
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available
This work is licensed under a Creative Commons Attribution 4.0 International License.