Antimicrobial peptide NK-lysin
General Information
DCTPep ID DCTPep01075
Peptide Name Antimicrobial peptide NK-lysin
Sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
Sequence Length 78
UniProt ID Not available
PubChem CID Not available
Origin Sus scrofa
Type Native peptide
Classification
ACP Tumor active peptide
Activity Information
| Cell Line | Disease | Activity | Assay | Testing Time | Literature |
|---|---|---|---|---|---|
| YAC-1 | Mouse lymphoma | LC90=50 µg/ml | Esuspension of the cell lines in 1% Nonidet P-40 | 2h | 1 |
Hemolytic Activity Sheep erythrocytes: 0% Hemolysis=170 µM
Normal (non-cancerous) Cytotoxicity Not available
Target Not available
Affinity Not available
Mechanism Not available
Structure Information
PDB ID Not available
Predicted Structure DCTPep01075
(Please note that there is the predicted structure, predicted by AlphaFold)
Helicity Not available
Linear/Cyclic Cyclic
Disulfide/Other Bond Cys4<--->Cys76; Cys7<--->Cys70; Cys35<--->Cys45
N-terminal Modification Free
C-terminal Modification Free
Other Modification None
Chiral L
Physicochemical Information
Formula C391H656N110O111S8
Absent amino acids H
Theoretical pI 9.17
Acidic residues 9
Basic residues 15
Polar residues 19
Molecular weight (Average) 8930.66
Molecular weight (Monoisotopic) 8924.68
Common amino acids KI
Net charge 6
Instability index (II) 31.64
Aliphatic index 93.72
Grand average of hydropathicity (GRAVY) -0.231
Half Life
30 hours (mammalian reticulocytes, in vitro).
>20 hours (yeast, in vivo).
>10 hours (Escherichia coli, in vivo).
Extinction coefficients
Ext. coefficient 7365
Abs 0.1% (=1 g/l) 0.825, assuming all pairs of Cys residues form cystines
Ext. coefficient 6990
Abs 0.1% (=1 g/l) 0.783, assuming all Cys residues are reduced
Amino acid distribution
Literature Information
Literature 1
Pubmed ID 7737114
Title NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity
Doi NA
Year 1995
Patent
Patent ID Not available
Patent Title Not available
Other Iinformation Not available
Other Published ID Not available