DCTPep ID  DCTPep01075

Peptide Name   Antimicrobial peptide NK-lysin

Sequence  GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Sequence Length  78

UniProt ID  Not available

PubChem CID  Not available

Origin  Sus scrofa

Type  Native peptide

Hemolytic Activity  Sheep erythrocytes: 0% Hemolysis=170 µM

Normal (non-cancerous) Cytotoxicity  Not available

Target  Not available

Affinity  Not available

Mechanism  Not available

PDB ID  Not available

Predicted Structure  DCTPep01075

(Please note that there is the predicted structure, predicted by AlphaFold)

Helicity  Not available

Linear/Cyclic  Cyclic

Disulfide/Other Bond  Cys4<--->Cys76; Cys7<--->Cys70; Cys35<--->Cys45

N-terminal Modification  Free

C-terminal Modification  Free

Other Modification  None

Chiral  L

Grand average of hydropathicity (GRAVY)  -0.231

Half Life 
  30 hours (mammalian reticulocytes, in vitro).
  >20 hours (yeast, in vivo).
  >10 hours (Escherichia coli, in vivo).

Extinction coefficients 
  Ext. coefficient 7365
  Abs 0.1% (=1 g/l) 0.825, assuming all pairs of Cys residues form cystines
  Ext. coefficient 6990
  Abs 0.1% (=1 g/l) 0.783, assuming all Cys residues are reduced

Amino acid distribution

Literature 1

Pubmed ID 7737114

Title  NK-lysin, a novel effector peptide of cytotoxic T and NK cells. Structure and cDNA cloning of the porcine form, induction by interleukin 2, antibacterial and antitumour activity

Doi NA

Year  1995

Patent

Patent ID Not available

Patent Title  Not available

Other Iinformation  Not available

Other Published ID  Not available